PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00048g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 92aa    MW: 10230.3 Da    PI: 4.3017
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00048g00003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.22.4e-173380149
                       NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                              + pGfrF+Ptdeelv++yLkkk+eg++  + evi+ev+i k+ePwdLp 
  Niben101Scf00048g00003.1 33 MFPGFRFSPTDEELVSYYLKKKLEGSDRCV-EVISEVEIWKHEPWDLPG 80
                              579************************777.99**************93 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-172982IPR003441NAC domain
PROSITE profilePS5100519.023392IPR003441NAC domain
PfamPF023655.8E-83576IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
IMEDGHVSGS RNENGTTPRN NNVEISIATA SSMFPGFRFS PTDEELVSYY LKKKLEGSDR  60
CVEVISEVEI WKHEPWDLPG RDGDMGVDGG LQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590635.15e-47PREDICTED: NAC domain-containing protein 89-like
RefseqXP_009758643.18e-47PREDICTED: NAC domain-containing protein 89-like
RefseqXP_016441918.15e-47PREDICTED: NAC domain-containing protein 89-like
RefseqXP_016449980.18e-47PREDICTED: NAC domain-containing protein 89-like
SwissprotQ9XIN73e-20NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A0V0IA203e-41A0A0V0IA20_SOLCH; Putative NAC domain-containing protein 89-like
TrEMBLM1A5E53e-41M1A5E5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150777e-41(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.12e-21NTM1-like 8